Abbiotec, LLC
7985 Dunbrook Road, Suite A
San Diego, CA 92126
Phone: 1 858 586 0500
Toll Free: 1 800 854 7453
Fax: 1 858 586 6252
Email Us
Catalog Number350048 Unit1 mg Price$257.00 FormatEach vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
DescriptionAmylin, also called Islet or insulinoma amyloid polypeptide (IAPP), is a 37-amino acid monomeric polypeptide isolated from pancreatic amyloid, which is commonly found in the islet of patients with diabetes mellitus type II and in insulinomas. Amylin is derived from a larger propeptide precursor of 89 amino acids in humans. Immunostaining of amylin is found in islet amyloid and in cells of the islets of Langherans, where it colocalizes with insulin in islet B cells. Recommended Products
Accession No.MW3918.47 g/mol SequenceRat: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Cys2-Cys7) or H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Cys2-Cys7) CompositionC167H270N52O53S2 PurityPurity > 95% by HPLC SolubilityDistilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. StorageStore at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| Proteoglycans, Metabolic Disorders | |
For research use only, not for diagnostic or therapeutic procedures.