Abbiotec, LLC
7985 Dunbrook Road, Suite A
San Diego, CA 92126
Phone: 1 858 586 0500
Toll Free: 1 800 854 7453
Fax: 1 858 586 6252
Email Us
Catalog Number350080 Unit1 mg Price$413.00 FormatEach vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
DescriptionBeta-amyloid production results from cleavage in the extracellular domain of APP by the beta-secretase (BACE1) , which results in the production of the APP C-terminal fragment C99. This fragment is further cleaved by the gamma-secretase at residues 40-42 to produce beta-amyloid 40 and 42 peptides. Beta-amyloid aggregation and neuritic plaque formation are pathologic hallmarks of Alzheimer disease. This peptide corresponds to the rat beta-amyloid 1-42 peptide. Recommended Products
Accession No.MW4418.05 g/mol SequenceRat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH CompositionC199H307N53O59S1 PurityPurity > 95% by HPLC SolubilityWe recommend using 100% dimethyl sulfoxide (DMSO). Alternatively, hexafluoroisopropanol (HFIP) can be used. StorageStore at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| Proteoglycans, Neurodegenerative Disorders | |
For research use only, not for diagnostic or therapeutic procedures.